PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS04665 FitnessBrowser__Koxy:BWI76_RS04665 (201 amino acids)

SeqID: BWI76_RS04665 FitnessBrowser__Koxy:BWI76_RS04665
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15598316: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    Extracellular          0.01
    OuterMembrane          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS04665 FitnessBrowser__Koxy:BWI76_RS04665
MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFQDDKGEQPNPE
FVLNFPEYKGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLL
PVTLSEAQVDELFKLVHSQPGIKFEVDLESEVVKAGDKSYSFKIDAFRRHCMLNGLDSIG
LTLQHEEAISAYEQKQPAFMN

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory