PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS07345 FitnessBrowser__Koxy:BWI76_RS07345 (258 amino acids)

SeqID: BWI76_RS07345 FitnessBrowser__Koxy:BWI76_RS07345
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 2507364: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS07345 FitnessBrowser__Koxy:BWI76_RS07345
MKKSLLLWVALMASTSALAVENKEIRFGVDPTFAPFEWKDPQGKLAGFDIDLGNAICAQL
QAKCVWVESNFDGIIPALKARKFDAILSGMYMTEKRKEQIGFSDKLYNGPVFLVARKNTL
AGNTVEQLKGKTIGVEQGSAQETYVNQHWRTAGINIVAYQGADRVVQDLESGRIDGAVLS
GMMADYSFLQQPQGKDFAFVGGHLKDDKLFGAGAAIGLRKEDDALRQEINGAIARILADG
TYKKLAGKYFSFDVYSGT

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory