PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS09080 FitnessBrowser__Koxy:BWI76_RS09080 (251 amino acids)

SeqID: BWI76_RS09080 FitnessBrowser__Koxy:BWI76_RS09080
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 16128794: molybdopterin synthase sulfurylase [Escherichia coli K12]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS09080 FitnessBrowser__Koxy:BWI76_RS09080
MGVELSDAEMLRYNRQIILRDFDFDGQEQLKASRVLVVGLGGLGCAAAQYLAAAGVGQLT
LLDFDTVSLSNLQRQTLHSDATIGQPKVDSARGALARMNPHVQLTTLNARLEDAALAAQI
AAHDLVLDCTDNVAIRNQLNAGCFRHKTPLVSGAAIRMEGQISVFTYQEDEPCYRCLSRL
FGDNALTCVEAGVMAPLVGIIGSLQAMEAIKLLARYGSPATGKIVMYDAMRCQFREMTLP
RNPHCEVCGTP