PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on BWI76_RS23100 FitnessBrowser__Koxy:BWI76_RS23100 (266 amino acids)

SeqID: BWI76_RS23100 FitnessBrowser__Koxy:BWI76_RS23100
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [7 internal helices found]
    Motif-            CytoplasmicMembrane           [matched PS00221: MIP Pattern - Cytoplasmic Membrane]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 20141735: Propanediol diffusion facilitator]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>BWI76_RS23100 FitnessBrowser__Koxy:BWI76_RS23100
MNDSLKAQCTAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTSGI
SGGHLNPAVTVALWLFACFPGRKVFPYIVSQVAGAFGGAVLAYVLYSTMFTEFESAHHIA
RGSVESLQLASIFSTYPAASLSIWHAALVEVVITSMLMGMIMALTDDGNGVPKGPLAPLL
IGLLVAVIGASTGPLTGFAMNPARDFGPKLFTWMAGWGDIAMTGGRDIPYFIVPIIAPLI
GACLGAAIYRYLIGNNLPCNTCKLED

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory