Running PSORTb v3.0 on CA265_RS15810 FitnessBrowser__Pedo557:CA265_RS15810 (212 amino acids)
SeqID: CA265_RS15810 FitnessBrowser__Pedo557:CA265_RS15810 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 15599889: acetolactate synthase isozyme III small subunit[Pseudomonas aeruginosa PAO1]] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Cytoplasmic 9.97 Periplasmic 0.01 CytoplasmicMembrane 0.01 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: Cytoplasmic 9.97 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>CA265_RS15810 FitnessBrowser__Pedo557:CA265_RS15810 MSTENTIEHKIDKADLDGKQEYTITVYAENRIGLLNRIAIIFSKRKINIESLNTSPSEID GIHRFNIVIHEGYEVVRKLARQIEKQIEVLKVYFNTNEEIIWQELALYKVSTDEIAEKVT VERLLRQYGASAVVIRKDYTVFAVTGHREETDALVKALEPYELIEFVRSARVAIIKDSAG FHEKLKEFEAFEPGEELVENEFLEKGQKIFTM
Lawrence Berkeley National Laboratory