PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on CCNA_00206 CCNA_00206 succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (236 amino acids)

SeqID: CCNA_00206 CCNA_00206 succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597195: DhcA, dehydrocarnitine CoA transferase, subunit A[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>CCNA_00206 CCNA_00206 succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
MVDKVKKDAVEALAGLLFDGMTIMAGGFGLCGIPENLIAAIREAGTKDLTVISNNCGVDG
FGLGILLENRQIKKMVSSYVGENKLFEQLYLSGELELEFNPQGTLAERIRAGGAGIPAFF
TRTGYGTLVAEGKETREFDGEMYVMERGLTADLSIVKAWKADAEGNLIYRKTARNFNPMM
ATAGKKTVVEVEELVAIGELDKDAIHTPGIYVDRLIKGAKFEKRIERVTTRQKETA