PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on CCNA_01413 FitnessBrowser__Caulo:CCNA_01413 (199 amino acids)

SeqID: CCNA_01413 FitnessBrowser__Caulo:CCNA_01413
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15596477: hypothetical protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>CCNA_01413 FitnessBrowser__Caulo:CCNA_01413
MIYLCRHGQTFHNREGRLQGRTESDLTPLGLLQAQAMGQLLGDLVRREPPAPWRLVASPL
RRARRTAEAIGEHLGLAVDFDERLVEIDVGEWSGRLREEVHGENPHLVGDDAWGFQAPGG
ETYEAMMVRLTSWLSEQATEPERRLIVVSHGVAGRLLRGAYAGLAQEETLRLDIPQDAIY
RLANGQIDRFDCAPIDEPA