Running PSORTb v3.0 on CCNA_03778 FitnessBrowser__Caulo:CCNA_03778 (250 amino acids)
SeqID: CCNA_03778 FitnessBrowser__Caulo:CCNA_03778 Analysis Report: CMSVM- CytoplasmicMembrane [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- CytoplasmicMembrane [7 internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 84027847: Inner membrane protein ybhL] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 10.00 Cytoplasmic 0.00 Periplasmic 0.00 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: CytoplasmicMembrane 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>CCNA_03778 FitnessBrowser__Caulo:CCNA_03778 MNDFNRGYARSIPADRADMSVDAGLRKFMLGVYNKVALGLVVSGALAYATSSVPAVRDLL FVVQGGRLAGVTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTIVSLIGASLGSVM LRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLIVASIVSIFLKSP ALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATNFGALSLYINFINLFQF LLSFFGGNRE
Lawrence Berkeley National Laboratory