PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Dsui_1624 FitnessBrowser__PS:Dsui_1624 (255 amino acids)

SeqID: Dsui_1624 FitnessBrowser__PS:Dsui_1624
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 1730535: Acetoacetyl-CoA reductase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Dsui_1624 FitnessBrowser__PS:Dsui_1624
MELKESVFVVTGGGSGLGAATARMIVAGGGKVVLADVNKAAGEALAAELGANARFAETDV
TNEASAKAAVELAVSTFGKLNGLVNCAGVAPAEKVLGKEGPHRLESFAKVININLVGSFN
MIRLATEVMAKGEPNAQGERGVIVSTASVAAFDGQLGQAAYAASKGGVVAMTLPIARELA
RSGIRVMTIAPGIMETPMLMGMPQEVQDSLGKMVPFPSRMGKPAEYAALVRHIVENSYLN
GEVIRLDGAIRMAAK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory