PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Dsui_2538 FitnessBrowser__PS:Dsui_2538 (246 amino acids)

SeqID: Dsui_2538 FitnessBrowser__PS:Dsui_2538
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 130015: Acetoacetyl-CoA reductase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            6.49
    CytoplasmicMembrane    3.24
    Extracellular          0.14
    OuterMembrane          0.14
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Dsui_2538 FitnessBrowser__PS:Dsui_2538
MSKVALVTGALGGLGTAISQALAKEGYKVVAAYHPEFDKKEEWLAEQEAAGFKDFVLVPG
DVSDYESAKAMIAEAEAKAGPIDILVNNAGITRDKFFVKMDKGQWDAVINTNLNSLFNVT
HHVAAKMGERGWGRIVNISSVNGVKGQAGQTNYSAAKAGVIGFTKALAQEFAAKGVTVNA
IAPGYVATKMVTAIREDILKGIIDSVPMKRLAKPEEIGAAVVYLTSELAGFVTGATLNIN
GGLYYQ

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory