PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Echvi_0089 FitnessBrowser__Cola:Echvi_0089 (134 amino acids)

SeqID: Echvi_0089 FitnessBrowser__Cola:Echvi_0089
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            8.96
    CytoplasmicMembrane    0.51
    Periplasmic            0.26
    Extracellular          0.26
    OuterMembrane          0.01
  Final Prediction:
    Cytoplasmic            8.96

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Echvi_0089 FitnessBrowser__Cola:Echvi_0089
MRKIEHLGIAVKDLKKSNELFSRLFGKEAYKEERVEDEGVLTSFFQVGDVKIELLEATAP
DSPIAKFIDKRAEGVHHVAFAVDDIYAEMDRLKKAGFEILNDVPKKGADHKLVVFLHPRS
TNGVLVELCQDDVK