PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Echvi_1841 FitnessBrowser__Cola:Echvi_1841 (141 amino acids)

SeqID: Echvi_1841 FitnessBrowser__Cola:Echvi_1841
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 30923261: Cytochrome c-552 precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Echvi_1841 FitnessBrowser__Cola:Echvi_1841
MNLSKLASAGAIALAGMAYACGGGSDTKSEETTSAAESAAPKKEMSFDEMYKDNPDYVEG
LALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQVPMPA
HPGLSEDDAKKMVKYILMLKK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory