PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Echvi_2506 FitnessBrowser__Cola:Echvi_2506 (189 amino acids)

SeqID: Echvi_2506 FitnessBrowser__Cola:Echvi_2506
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15595846: anthranilate synthase component II[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Echvi_2506 FitnessBrowser__Cola:Echvi_2506
MKILVLDNYDSFTYNLVYIVRELGYGAEMDVFRNDKIKVEDVAAYDKILLSPGPGVPADA
GIMPELLKQYAKEKDILGVCLGHQAIGEAFGSGLNNLTEVVHGVASEVKVFQRDLLFEGV
PDNFKIGRYHSWVIDESTLSDDLEITAKTPDGQIMAVRHKSYKVRGLQFHPESVLTEHGK
QIVQNWING