PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Echvi_2514 Echvi_2514 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (194 amino acids)

SeqID: Echvi_2514 Echvi_2514 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 45593460: Imidazole glycerol phosphate synthase subunit hisH]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Echvi_2514 Echvi_2514 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
MDVAIIKYNSGNVLSVLYALERLGINANLTDDVEEIKKADKVIFPGQGEASSAMRYLRER
NLDQLIKDLKQPFFGICLGQQLLCEYSEENDTECLGVFPVKVRKFPPADKVPHVGWNSLQ
ETQGQLLEGINTHDYVYYVHSYFAEIHPEFTVAKTHYIEDFSALLQKDNFYAMQAHPEKS
SHSGQKILTNFLKL