PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF1282 HP15_1252 membrane protein containing probable solute: sodium symporter, small subunit domain (88 amino acids)

SeqID: GFF1282 HP15_1252 membrane protein containing probable solute: sodium symporter, small subunit domain
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [2 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.82
    Periplasmic            0.12
    Cytoplasmic            0.04
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    CytoplasmicMembrane    9.82

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF1282 HP15_1252 membrane protein containing probable solute: sodium symporter, small subunit domain
MSAGHSYDAEAYWKANLRLIFGSLIVWALVSYGFAILLRPMLAGIPIGGTDLGFWFAQQG
SILTFIALIFHYAWRMNKIDEKFGVHEE