PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF1645 PGA1_c16680 sugar ABC transporter, ATP-binding protein (355 amino acids)

SeqID: GFF1645 PGA1_c16680 sugar ABC transporter, ATP-binding protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 20141512: Maltose/maltodextrin import ATP-binding protein malK]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF1645 PGA1_c16680 sugar ABC transporter, ATP-binding protein
MARIELRDVAKRYGAVEVLRDINLDIQDGEFIVLVGPSGCGKSTLLRMIAGLEPITSGDF
EIDGQRMNDVRPRDRDIAMVFQSYALYPHMDVARNMGFSMEIRKDPAEERRSRVARAAET
LGLSSLVDRLPKALSGGQRQRVAMGRAIIRDPRAFLFDEPLSNLDAALRVEMRLEIARLH
KQLGATMIYVTHDQVEALTLADRIVVLNGGDIQQVGSPLELYERPANKFVAQFIGSPTMN
ILPVSGAASGVMATNGMMLTLDHMHDTAAAVELGIRPEHLDVVEPGEGHLIAVADVVERL
GSDTNIYAKVDGLGPLMVRKHGNVPVRSGERLGLRVQAQNAHIFDDRGIALRPAA