PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF1767 FitnessBrowser__Phaeo:GFF1767 (247 amino acids)

SeqID: GFF1767 FitnessBrowser__Phaeo:GFF1767
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 2507045: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF1767 FitnessBrowser__Phaeo:GFF1767
MMIYPTMELKDGRCVTLDKGRLDTAMVWHVDPVATACSFAADGAEWMHLTDFDAIEGDNR
NAGLVEEIIRTAGIPVQLGGGMRSREHVEHWIDKGAGRVVVGTLAAQDPEMVRMLTRLYP
DQIVLAVDVWEGQVMTDGWRQAGSFTPEAFIEAFADCPFAGIIITDIESDMSDVEAQLGL
IAGLAEKARTPVIASGVVRTADDVARLKYIGSVSGTLVGRALFRKTLTLAEALEEAAPSR
EPVAEFR