PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF2160 FitnessBrowser__WCS417:GFF2160 (287 amino acids)

SeqID: GFF2160 FitnessBrowser__WCS417:GFF2160
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.00
    Cytoplasmic            2.00
    OuterMembrane          2.00
    Periplasmic            2.00
    Extracellular          2.00
  Final Prediction:
    Unknown

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF2160 FitnessBrowser__WCS417:GFF2160
MSCIAVTPHRAQLGEGPFWDAPTQALYWVNIAGKQALRLMGGQLQVWQLPEHVSAFIPCE
SGDALVTLSSGVYRLDLATEALTLLCVADPQPGNRGNEARCDASGRLWLGTMQNNIGEQG
EDLPITRRSGGLFRIDADAQVTPLLSGLGIPNTLLWSDDGRHVHFGDSLDGTLYRHAIQP
DGQLDPAQTWFGPHERGGPDGSAMDVDGYIWNARWDGSCLLRLTPDGEVDRIVELPVSRP
TSCVLGGPNLTTLYITSAASPLDHPLDGAVLAMEVDVPGKPCHRFAG

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory