PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF2286 FitnessBrowser__Phaeo:GFF2286 (292 amino acids)

SeqID: GFF2286 FitnessBrowser__Phaeo:GFF2286
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 129056: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF2286 FitnessBrowser__Phaeo:GFF2286
MSDIIAPPSVRALARQKGIDLEKLAKELGRTSIVREDLESGKTTSGPAGDTSYWDVDHSQ
FGSVGEELMSRFAQVAAANLSAANALIPQVTHHDRADVTAIEALRKELKPEAQARGVKLT
ALAFQAKALARALREFPRFNASLSPDGKTLTLKGYVHIGIAVDTAHGLMVPVVHDVDRKG
LWQIAAEISDLASRAQNRKVGPDEMGGASMTITNLGGIGGIGFTPIVNPPEVAILGITRT
ETVTVWDDDTPRPVTMVPLDLSYDHRVINGADAARFVSYFAGLIADPRRIMV