PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A (308 amino acids)

SeqID: GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 30179893: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A
MINVQFAALPERWATYETPLRAAFAEAGLKVDLRLDHTPDEVDYVVYAPNSDLQDFTPYT
RCKAVLSLWAGVEKIVGNRTLTMPLCRMVDPGLTAGMVEWVTGHVLRYHLNIDRTIHTQD
RWEPVVPPLAEERPVTVLGLGALGQACASMLATLGFPVTGWSRSKKSIDGITCRHGDDGL
RDALATAQIVILLLPDTHATENTLNSDTLALLPKGARIINPGRGPLIDDDALLAALDSGQ
IGHATLDVFRIEPLPMDHPYWAHPRVTVTPHIAAETRPLTAARVIADNIRRGEAEAPFLH
QVDRTLGY

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory