PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF2734 FitnessBrowser__WCS417:GFF2734 (170 amino acids)

SeqID: GFF2734 FitnessBrowser__WCS417:GFF2734
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 16129542: spermidine N1-acetyltransferase [Escherichia coli K12]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF2734 FitnessBrowser__WCS417:GFF2734
MHTPEPHIVIQRFTEAHLEGVAALYNEPAVCRQVLQMPFQSVEAWRNKLVQDNERRLQLV
AVHGGEVIGQLGLEQYLRVRRAHVGSFGMGVATAWQGKGVGSRLLTAALDVADNWMNLRR
VELTVYADNDAAQALYRKFGFEVEGVLRDYALRDGQFVDTVSMARLRTSV

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory