PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF3014 HP15_2958 extracellular solute-binding protein family 1 (416 amino acids)

SeqID: GFF3014 HP15_2958 extracellular solute-binding protein family 1
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15598386: probable binding protein component of ABC sugar transporter[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF3014 HP15_2958 extracellular solute-binding protein family 1
MTMTTFKKTLTAAAVSAALLPAQALQAGEVEVLHWWTAGGEARAAVALKEMMEDQGHTWK
DFAVAGGGGEAAMTVLKTRAVSGNPPAAAQIKGLDIREWAKLGFLTSLDDVAEANNWGQL
IPPVIADVMQYEDSYVAVPVNVHRVNWLWANPETLNKVGVGVPKTLDEFYQAAEKLKAAG
ITPLAHGGQPWQDATVFEAVALAVMGPDDFASAFVEHDMDVINSAQMEEVFAEFAKVMSY
VDDNAAGRDWNTATGMVIRGEAAMQIMGDWAKGEFTAAGLTPGEDYVCAAAPGTGGQFTF
NVDSFAMFSLSDEDNTKAQKDLARTIMEPEFQAVFNKAKGSIPVRTDFDTCAQASMDTFK
SSAEDGGLVPSFAHGLATTSYVQGQIFDVVTNFVNSDNKDPARATDQLAAAIQAAL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory