PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF3053 FitnessBrowser__Marino:GFF3053 (273 amino acids)

SeqID: GFF3053 FitnessBrowser__Marino:GFF3053
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2506102: Ferrichrome transport ATP-binding protein fhuC]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF3053 FitnessBrowser__Marino:GFF3053
MVLCINNVSVSLERSRIVHGIDCHLEAGEVLMLLGPNGAGKSTLLRAISGDLPYGGSVTL
SGQELGKWRPERLARQRAVMPQRVEVNFPLTVEEVVQLGRPGTARGGSDPTVDRLMEELD
IAHLRYRLVPGLSGGEQQRLQLARVLAQIIDSPGDRLLLLDECTAALDPAHQQLVLDLVR
RLAKAEGMAVLAVVHDLNLAAQFADRLLLMREGRLVHEGSAREVLTPELLETVYGFTARV
VELEEGYPMVVPARTGPSSAYTAPWNPSCRQAS