PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF3112 HP15_3055 high-affinity leucine-specific leucine-specific-binding periplasmic protein of high-affinity branched-chain amino acid ABC transporter transport system periplasmic binding protein (370 amino acids)

SeqID: GFF3112 HP15_3055 high-affinity leucine-specific leucine-specific-binding periplasmic protein of high-affinity branched-chain amino acid ABC transporter transport system periplasmic binding protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 12230875: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF3112 HP15_3055 high-affinity leucine-specific leucine-specific-binding periplasmic protein of high-affinity branched-chain amino acid ABC transporter transport system periplasmic binding protein
MRTSVKKLVTAVSTSVALMGAGHAAAEIQIGIAGPMTGPVAQYGDMQFSGARMAIEQINA
NGGVMGEELVAVEYDDVCDPKQAVTVANSLVNDGVRFVIGHLCSSSTQPASDIYEDEGIL
MVTPASTSPEITERGYELVFRTIGLDSMQGPVAARYIASQNPERVAIVHDKQQYGEGIAT
AVRDTLKDAGVEIAMFEGITAGDKDFSSLVTKLKQADVDYVYYGGYHPELGLILRQANSA
DLDARFMGPEGVGNKDINTIAGEAAEGLLVTLPPAFDQKAENQALVKAFEDKGEDPSGPF
VLTSYTAVQLVAEGIEAAGSTDPFDVAAALREGTFQTPIGTVEYDKAGDMKSFEFVVYEW
HSDGSKTPVN

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory