PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF354 FitnessBrowser__Phaeo:GFF354 (320 amino acids)

SeqID: GFF354 FitnessBrowser__Phaeo:GFF354
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 126063: L-lactate dehydrogenase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF354 FitnessBrowser__Phaeo:GFF354
MARPKIALIGAGQIGGTLAHLAALKELGDVVLFDIAEGTPEGKALDIAESGPSEGFDAKL
KGTQSYEDIAGADVCIVTAGVPRKPGMSRDDLLGINLKVMKSVGEGIRDHAPDAFVICIT
NPLDAMVWALREFSGLPHEKVCGMAGVLDSARFRHFLAEEFNVSMKDVTAFVLGGHGDTM
VPLTRYSTVAGIPLPDLVKMGWTSQEKLDAIVQRTRDGGAEIVGLLKTGSAFYAPATSAI
EMAEAYLKDQKRVLPCAAYVDGALGLKGMYVGVPTVIGAGGIERVIDIKMTSDEQTMFDN
SVNAVKGLVEACKGIDGSLA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory