PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF362 Psest_0363 tripartite ATP-independent periplasmic transporter solute receptor, DctP family (323 amino acids)

SeqID: GFF362 Psest_0363 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 586718: 2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    CytoplasmicMembrane    0.12
    Extracellular          0.11
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF362 Psest_0363 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
MNLKRKLLVTALPFAFCISGLAHAMTLKIAEIHPAGYPTVVAMENLGKKLETATNGEIKS
RMFAGGVLGSEKEVIEQTQIGAVQLTRVSLGSVGPVVPATNVFNMPFVFRDIDHMRKVVD
GEIGQEILDAITNSDFNMVGLAWMEAGSRSLYTKKPIRRIEDLKGMKIRVIGNPLFIDTL
NAMGANGIAMDTGEIFSALQSGVIDGAENNSPTLLEHNHFRVAKHYTQTHHLILPEPLLM
SKDTWNKLSPEQQATVKKLAKEAQLEERDLWVAKETASNEKLKAEGVEFIEVDTKPFYDA
TAPVREKYGAQFAELIKRIEAVQ