PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF4241 Psest_4314 ABC-type metal ion transport system, ATPase component (335 amino acids)

SeqID: GFF4241 Psest_4314 ABC-type metal ion transport system, ATPase component
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 130990: Glycine betaine/L-proline transport ATP-binding protein proV]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    7.88
    Cytoplasmic            2.11
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    7.88

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF4241 Psest_4314 ABC-type metal ion transport system, ATPase component
MIEFHQVHKTYRTGGRDVPALQPTQLEIASGEVFGLIGHSGAGKSTLLRLINRLEEPSGG
RILVNGEDVTALDADGLRRFRQRVGMIFQHFNLLMSKTVADNVAMPLRLAGIRSRREIDA
RVAALLERVGLKEHARKYPAQLSGGQKQRVGIARALATEPSILLCDEATSALDPQTTASV
LQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGAIVEQGPVTEVFLHPKHPTTQR
FVLEDEAMDESELHDDFAHVPGRILRLTFQGDSTYKPLLGTVARETGVDYSILSGRIDRI
KDTPYGQLTLALIGGDMTAAMTRLQAADVHVEVLR