PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF5097 FitnessBrowser__WCS417:GFF5097 (241 amino acids)

SeqID: GFF5097 FitnessBrowser__WCS417:GFF5097
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 121397: Glutamine transport ATP-binding protein glnQ]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF5097 FitnessBrowser__WCS417:GFF5097
MVQISGLNKWYGNFQVLHAIDLTVSQGERIVLCGPSGSGKSTLIRCISRLEVADSGVIRA
LDADLGKPSPARHKALREIGMVFQNFNLFPHMTVLQNCTLAPMSVRGFSRKRAEAHARHF
LDKVGIENQANKYPSQLSGGQQQRVAIARALCMEPKIMLFDEPTSALDPEMVKEVLDVIV
TLADTGMTMLCVTHEMGFARQVAERVLFLDAGRIVEDLPPEQFFTAPKSDRAQAFLAQIH
H

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory