PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF554 FitnessBrowser__psRCH2:GFF554 (187 amino acids)

SeqID: GFF554 FitnessBrowser__psRCH2:GFF554
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            8.96
    CytoplasmicMembrane    0.51
    Periplasmic            0.26
    Extracellular          0.26
    OuterMembrane          0.01
  Final Prediction:
    Cytoplasmic            8.96

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF554 FitnessBrowser__psRCH2:GFF554
MSVNVYCEDPRPALKELNVQIRDALDADLEGILHIYNDAVLNSTAIWNDHTVDLDNRRAW
LAERHAQHYPVLVAIDEQGRVAGYASFGPWRPHDGFRHTVENSVYVSPDHRGSGIGRSLM
KALIERARVLEKHVMVAFIESENRASVHMHQQLGFIHVGQMRQVGCKFGRWLDLTMMQLT
LNRTSNP