PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF720 PGA1_c07350 2-dehydro-3-deoxy-6-phosphogalactonate aldolase DgoA (203 amino acids)

SeqID: GFF720 PGA1_c07350 2-dehydro-3-deoxy-6-phosphogalactonate aldolase DgoA
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 1703252: KHG/KDPG aldolase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF720 PGA1_c07350 2-dehydro-3-deoxy-6-phosphogalactonate aldolase DgoA
MSRNIIAILRGLRSEEARAMTDALIAAGITKIEVPLNSPLPYDSIAAMLDQAKGRATVGA
GTVLNTDAVAQLSAMGAQMVISPDCNPDVIRAAKAAGMLSYPGVFTASECFSALRAGADG
LKFFPAFKLGLDGFSALKAVLPADAETYAVGGVGPADFADWQKAGITGFGIGSSLYKPGR
TVEDVARLAAETVAAYDEAFDGK