PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on GFF911 FitnessBrowser__Phaeo:GFF911 (240 amino acids)

SeqID: GFF911 FitnessBrowser__Phaeo:GFF911
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            CytoplasmicMembrane           [matched PS00192: CYTOCHROME_B_HEME Pattern - Cytoplasmic Membrane]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 20141331: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    5.95
    Cytoplasmic            4.05
    Periplasmic            0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>GFF911 FitnessBrowser__Phaeo:GFF911
MILYPAIDLKDGQAVRLLHGDMEKTTVFNDDPAAQALEFVEAGCDWLHLVDLNGAFAGEP
VNAAPVEKILKRCKVPAQLGGGIRDMATIERWIDKGLARVILGTVAVENPDLVREAARAF
PGKVAVGIDARNGRVATKGWAEETDVMVTDLAKSFEDAGVAAIIYTDILRDGAMKGPNVE
ATAALANAVSIPVIASGGVSSLADLQALKSCGAPLNGAISGRALYDGAIDLGEALKILKS