PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562 (232 amino acids)

SeqID: Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2829633: Cytoplasmic membrane integral membrane protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.82
    Cytoplasmic            0.15
    OuterMembrane          0.01
    Extracellular          0.01
    Periplasmic            0.01
  Final Prediction:
    CytoplasmicMembrane    9.82

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562
MSIDPAADIAIRARNVTLTLGTREAPTEILKGIDVDIARGSSVAILGPSGSGKSSLMAIL
SGLERASGGEVSVAGIAYGTLDEDGLARARRGRVGIVLQAFHLLPTMTAHENVAVPLELA
GAPDAFARAGAELDAVGLGHRLTHYPVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLD
GATSGAIVDLLFDRQRAADATLLIITHDPALAERCDRVLTMRDGLIVADSAA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory