Running PSORTb v3.0 on Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562 (232 amino acids)
SeqID: Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 2829633: Cytoplasmic membrane integral membrane protein] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 9.82 Cytoplasmic 0.15 OuterMembrane 0.01 Extracellular 0.01 Periplasmic 0.01 Final Prediction: CytoplasmicMembrane 9.82 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>Ga0059261_0562 FitnessBrowser__Korea:Ga0059261_0562 MSIDPAADIAIRARNVTLTLGTREAPTEILKGIDVDIARGSSVAILGPSGSGKSSLMAIL SGLERASGGEVSVAGIAYGTLDEDGLARARRGRVGIVLQAFHLLPTMTAHENVAVPLELA GAPDAFARAGAELDAVGLGHRLTHYPVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLD GATSGAIVDLLFDRQRAADATLLIITHDPALAERCDRVLTMRDGLIVADSAA
Lawrence Berkeley National Laboratory