PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ga0059261_2886 FitnessBrowser__Korea:Ga0059261_2886 (249 amino acids)

SeqID: Ga0059261_2886 FitnessBrowser__Korea:Ga0059261_2886
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            8.96
    CytoplasmicMembrane    0.51
    Periplasmic            0.26
    Extracellular          0.26
    OuterMembrane          0.01
  Final Prediction:
    Cytoplasmic            8.96

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ga0059261_2886 FitnessBrowser__Korea:Ga0059261_2886
MKILVPVKRVLDYNVKPRVKADGTGVDLANVKMSMNPFDEIAVEEAIRLKEKGAATEIVV
VSIGEQKAQETLRTALAMGADRAILIVAEDKVEPLGVAKLLAKVAEAEAPGLIILGKQAI
DDDNNQTGQMLGALLGWGQGTFANKVEIAGEQVDVTREVDGGLETVKLKLPAIVTTDLRL
NEPRYASLPNIMKAKSKPLDQKTPADYGVDVAPRLTVVSVTEPAKRQAGVKVADVDELVG
KLKALGVAK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory