PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Ga0059261_3272 FitnessBrowser__Korea:Ga0059261_3272 (221 amino acids)

SeqID: Ga0059261_3272 FitnessBrowser__Korea:Ga0059261_3272
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            CytoplasmicMembrane           [matched PS00221: MIP Pattern - Cytoplasmic Membrane]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Ga0059261_3272 FitnessBrowser__Korea:Ga0059261_3272
VTLARRVIAEFTGTAMLLAIVVGSGIMGERLSGGNDAIALLGNTLATGAGLIVLIQMFGP
ISGAHFNPAVTLTLLLKRESDARTAALYAAAQFAGAILGVWVAHAMFAEPVLQLSAKARD
GLPQGLAEAVATFGLIGTILCTGRHRPDATPVAVGLYITAAYWFTSSTSFANPAVTVART
LSDSFAGIAPHSAPLFVAGQLAGAIAALLFFTWLLREERPQ