PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on H281DRAFT_06609 FitnessBrowser__Burk376:H281DRAFT_06609 (198 amino acids)

SeqID: H281DRAFT_06609 FitnessBrowser__Burk376:H281DRAFT_06609
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 3123196: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>H281DRAFT_06609 FitnessBrowser__Burk376:H281DRAFT_06609
VSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQSRYQT
PDEAESDIRRRVENKEVVIGFGHPVYTISDPRNKVIKEVAKKLSKEAGNNKLFDIAERLE
SVMWEAKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVIARTAGWSAHIIEQRLDNKIIRPS
ANYTGPENLKYVPLNRRK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory