PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on HSERO_RS02535 FitnessBrowser__HerbieS:HSERO_RS02535 (249 amino acids)

SeqID: HSERO_RS02535 FitnessBrowser__HerbieS:HSERO_RS02535
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 1730032: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>HSERO_RS02535 FitnessBrowser__HerbieS:HSERO_RS02535
MLLKDKVAIITGGAGQNGLGFSTARLMAAQGARIVILDLERAEPAGAAARLGAQHLGLVA
DVTDKAACEAAAAAVLKQFGRIDILVNNAGVTQPAKLLEITGKDYDRILDVSLRGTLYMS
QAVLPAMQAQQSGSIVCISSVSAQRGGGILGGPHYSAAKAGVLGLARAMAREFGPQGIRV
NCITPGLISTDINKDILSAEKKAEIAQTIPLGRLGGPDDVGGVCVFLASDLSQYCTGVTL
DVNGGMLIH

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory