PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on HSERO_RS13915 FitnessBrowser__HerbieS:HSERO_RS13915 (284 amino acids)

SeqID: HSERO_RS13915 FitnessBrowser__HerbieS:HSERO_RS13915
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 16129178: 3-deoxy-D-manno-octulosonate 8-phosphate synthase [Escherichia coli K12]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>HSERO_RS13915 FitnessBrowser__HerbieS:HSERO_RS13915
MKLCGFDVGLDHPFFLIAGTCVIESEQMALDTAGTLKEITAELGIPFIYKSSFDKANRSS
GSSFRGLGMEKGLEILAKVKKEIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFI
RACAQSGKPVNIKKGQFLAPHDMVNVIDKARAAAKEAGLPTDQFMACERGVSFGYNNLVS
DMRSLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAIAVGISGVFMETH
PNPAEAKSDGPNAVPLARMKDLLGTMIDLDRIVKKAGFLENHFS