PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on HSERO_RS19240 HSERO_RS19240 arginine ABC transporter ATP-binding protein (242 amino acids)

SeqID: HSERO_RS19240 HSERO_RS19240 arginine ABC transporter ATP-binding protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 121397: Glutamine transport ATP-binding protein glnQ]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>HSERO_RS19240 HSERO_RS19240 arginine ABC transporter ATP-binding protein
MIELNNVSKWYGSFQVLTDCSTSVKKGDVVVVCGPSGSGKSTLIKTVNGLEPFQKGTITV
DGVSVGDPKTNLSKLRARIGMVFQNFELFPHLSIRENLTIGQIKVLGRSKEEATEKGLKY
LDRVGLLAHKDKFPGQLSGGQQQRVAIARALSMDPIAMLFDEPTSALDPEMINEVLDVMV
GLAQEGMTMMVVTHEMGFARKVANRVVFMDKGVVVEDCAKDEFFAQPRSERARDFLAKII
TH

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory