PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on HSERO_RS20330 FitnessBrowser__HerbieS:HSERO_RS20330 (198 amino acids)

SeqID: HSERO_RS20330 FitnessBrowser__HerbieS:HSERO_RS20330
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 123158: Histidine biosynthesis bifunctional protein hisB]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>HSERO_RS20330 FitnessBrowser__HerbieS:HSERO_RS20330
MSTPRTAEVVRNTNETQIRVAINLDGTGQQKLDTGVPFLDHMLDQIARHGLIDLDIHAKG
DLHIDAHHTVEDVGITLGMAFAKAIGDKKGIRRYGHAYVPLDEALSRVVIDFSGRPGLEY
HIPFTRSMIGSFDVDLTSEFFHGFVNHAQVTLHVDNLRGVNAHHQAETVFKAFGRALRMA
VELDPRAAGTIPSTKGSL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory