PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on N515DRAFT_0740 FitnessBrowser__Dyella79:N515DRAFT_0740 (275 amino acids)

SeqID: N515DRAFT_0740 FitnessBrowser__Dyella79:N515DRAFT_0740
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS00087: SOD_CU_ZN_1 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 6014910: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Periplasmic            6.00
    Cytoplasmic            4.00
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>N515DRAFT_0740 FitnessBrowser__Dyella79:N515DRAFT_0740
MQSIESLINDAFERRNDLTQSDIETYLRPAVEQVIDLLESGERRVAEPDGHGGWTVNQWI
KKAVLLYFRINGNRVVDGGSALAFDKVPLRFAHGNDAELQGLGARVVPGALVRRGAHVAK
DAVLMPSYVNIGAYVGAGSMVDTWATVGSCAQIGAHVHLSGGVGIGGVLEPLQANPTIIE
DNCFIGARSEVVEGVVVEKGSVIGMGVFLGQSTRIYNRATGQISYGRVPAGSVVVAGSLP
AKDGTHSLYAAIIVKQVDEKTRSKTSINELLRSAE

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory