PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on N515DRAFT_1223 FitnessBrowser__Dyella79:N515DRAFT_1223 (112 amino acids)

SeqID: N515DRAFT_1223 FitnessBrowser__Dyella79:N515DRAFT_1223
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.00
    Cytoplasmic            2.00
    OuterMembrane          2.00
    Extracellular          2.00
    Periplasmic            2.00
  Final Prediction:
    Unknown

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>N515DRAFT_1223 FitnessBrowser__Dyella79:N515DRAFT_1223
MYFALDLHDDPQSIAEYERWHRPGQIWPEIVASIREAGVLDLEIFRTRNRLVLAMDVTDD
FDGAAKAAADAANPRVQAWESLMDTFQQRLPWAKPGQKWVPMERIFSLRECP

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory