PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on N515DRAFT_3233 N515DRAFT_3233 xylose ABC transporter membrane protein (380 amino acids)

SeqID: N515DRAFT_3233 N515DRAFT_3233 xylose ABC transporter membrane protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [10 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 84029538: Xylose transport system permease protein xylH]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>N515DRAFT_3233 N515DRAFT_3233 xylose ABC transporter membrane protein
MQAQSIQQLFARYKILALLLAVAAIWVFFHVATGGDFVTARNVSNLFRQMAITGMLACGM
VFVIIAGEIDLSVGSLLGLLGGVVAVLTVNQGWSTPVAIVAVLGLGVLIGLFNGFWVTRL
RVPSFIVGLGGMLAFRGVLLGTTHSATIAPVPADLVYLGQGYVSPLWSTVLGVAIFAVVV
ALAVLRRRRRAQLQIRQLPWWADLLKVVAIGAALGVFVATLNSYGGIPLPVLILVALLAV
FSYLASQTVLGRHIYAVGGNLEATRLSGVNVARVKLVVFGIMGLMCAFAGIVNTARLAAG
SPSAGTNGELDAIAACFIGGASMRGGAGTVHGALIGALVMASLDNGMSMMDVDTYWQYIV
KGAILVLAVWVDVLSRPQRD

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory