PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PP_2760 PP_2760 putative ribose transport permease protein (327 amino acids)

SeqID: PP_2760 PP_2760 putative ribose transport permease protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [10 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 20141728: Ribose transport system permease protein rbsC]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PP_2760 PP_2760 putative ribose transport permease protein
MPMPLLSDAFHPRFAQWLLRRGALLAFAAILLAFALSAPNFLTLSNLVNVLAQSAILGSL
AFGLTTVIIGGGSNVVSGGLDLSLAANLGLSAAVYASLNNAGFGDVVSIAATLGTGLAIG
TLNALVVVGFRLPPLLATLATMNLVAGLELVLTENTVLPSTSPLLEGLAFGSWVGVPALA
WVLLAVGGVLIVLTQYTPFGLRLYAIGEYPEAANAAGLSVRGYVFASYLISGLCGSLAAF
CSAAWFSGSTTGSGEMLLSVVAIAFLGVIFSQRLQPSIGGTLLATLLVGVLINGFQLLNI
SSFWVDGVQGVLILLVVALSGLRNKEA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory