PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PP_4483 FitnessBrowser__Putida:PP_4483 (254 amino acids)

SeqID: PP_4483 FitnessBrowser__Putida:PP_4483
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2506103: Histidine transport ATP-binding protein hisP]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PP_4483 FitnessBrowser__Putida:PP_4483
MYKLEVQDLHKRYGSHEVLKGVSLAAKAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKI
LLNNEELKLVPGKDGALKAADPRQLQRMRSRLSMVFQHFNLWSHMTALENIIEAPVHVLG
VNKKEALEKAEHYLAKVGVAHRKDAFPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSAL
DPELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGLVEETGCPREVLANP
QSERLQQFLSGSLK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory