PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PP_4694 FitnessBrowser__Putida:PP_4694 (300 amino acids)

SeqID: PP_4694 FitnessBrowser__Putida:PP_4694
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 115305766: Glutamyl-tRNA synthetase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PP_4694 FitnessBrowser__Putida:PP_4694
MPSLTMTDSSYIGRFAPTPSGFLHFGSLVAALASWLDARAVNGRWLLRMEDTDPPREMPG
ARDAILQTLERYGLHWDGEVVFQSQRHDAYAAVVDRLFNMGLAYACTCSRKQLESYNGIY
PGFCRNAGHAREGAAIRLRVPELIYRFTDRVQGEYQQHLGREVGDFVIQRRDGLYAYQLA
VVLDDAWQGVTDIVRGADLLDNTPRQLYLQELLGFSQPRYLHIPLIVQPDGHKLGKSYRS
PPLQAEHATPLLLRALRALGQETDPELLLATPAEVLAVARAQWRPEAIAQRTTVPEADLR