PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf1N1B4_1693 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1693 (264 amino acids)

SeqID: Pf1N1B4_1693 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1693
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 84028140: Cystine-binding periplasmic protein precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf1N1B4_1693 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1693
MNFSALRRNLLVGSLGLALSAGLLGQAVAGEQLQKIKDAGVINVGLEGTYPPFSFVDEAG
KLSGFEVEFSEALAKELGVKVKLQPTKWEGILAALESKRLDAVINQVTITEERKKKYDFS
TPYTVSGIQALTLTKNKDTIKTAADLAGKKVGVGLGTNYEQWVKENVPKADVRTYEDDPS
KFQDLRVGRIDAILIDRLAALEYARKAKDTAAAGEAFSRQEAGIALRKGEPELLAAVNKA
IDKLRADGTLKKLSEKYFSADVTQ