PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf1N1B4_3175 Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1) (254 amino acids)

SeqID: Pf1N1B4_3175 Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 2506103: Histidine transport ATP-binding protein hisP]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    OuterMembrane          0.00
    Extracellular          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf1N1B4_3175 Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)
MYKLTIEGLHKSYGDHQVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAM
SLDGQTIRMIHDRHGMRVADADELQRIRTRLAMVFQHFNLWSHMTVLENITMAPRRVLGC
SKQEAEDRARRYLDKVGLAARVADQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSAL
DPELVGEVLKVIQGLAEEGRTMIMVTHEMSFARKVSSQVLFLHQGLVEEEGAPEDVLGNP
KSERLKQFLSGNLK