PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf1N1B4_3179 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3179 (260 amino acids)

SeqID: Pf1N1B4_3179 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3179
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15598119: periplasmic histidine-binding protein HisJ[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf1N1B4_3179 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3179
MKKALLTLSALALCMAAGSALAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAIC
AELKVKCKWVESDFDGMIPGLKANKFDGVISSMTVTPAREKVIDFSDELFSGPTAYVFKK
GSGLSEDVASLKGKTVGYEQGTIQEAYAKAVLDKAGVKTQAYQNQDQVYSDLTSGRLDAA
IQDMLQAELGFLKSPKGEGYEVSKPVDSELLPSKTAIGISKGNKDLKELLNKGIKALHDD
GTYATIQKKHFGDLNLYSGK