PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf1N1B4_4954 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4954 (248 amino acids)

SeqID: Pf1N1B4_4954 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4954
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 1708001: Cytoplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf1N1B4_4954 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4954
MSRLQGKRTLITGGTSGIGLETAKQFLAEGARVIVTGVNPESMANAQAILGSEVLVLRAD
SASVAAQKELAQAVQSHYGQLDVAFLNAGVSVWMPIEDWNEEMFDRSFDINVKGPYFLLQ
ALLPVFSNPASVVLNTSVSAHLGAARSSIYAATKAAFLNMSKTLSSELLPRGVRVNAVSP
GPIDTPLYDKAGIPDAYREQVNKDIAATIPFGRFGTPEEVAKAVLYLASDESRWTVGTEI
IVDGGRSL

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory