PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf6N2E2_3238 TRAP-type C4-dicarboxylate transport system, periplasmic component (331 amino acids)

SeqID: Pf6N2E2_3238 TRAP-type C4-dicarboxylate transport system, periplasmic component
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15600360: probable c4-dicarboxylate-binding protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf6N2E2_3238 TRAP-type C4-dicarboxylate transport system, periplasmic component
MLKPIWKTLLCTLALSAGGNALAAEPIVIKFSHVVGEQTPKGQGALMFKKLAEERLPGKV
KVEVYPNSTLYGDDKEMEALLLGEVQIIARSLAKFEQYTKSVQLFDLPFLFDDIPAVDRF
QQSPEGQKLLKSMESKNITGLAYWHNGMKQLSANKPLRTPEDARDLTFRIQTSAVLEEQF
KAVDAKAKPMIFSVVYQGLRTGLVNGTENTYSNFYNQKLNEVQKYVTESNHGILDYMLIT
TSDFWKGLPPDIRSELDKIVVESTAYANQEAERFNQQDKQHVLDAKTTEIITLTPEQRNA
WREKMKPVWAKFEQEIGPDLIKAAQASNKAQ